Recombinant Streptavidin
High Affinity, High Stability, High Purity
Home > Protein Expression > Recombinant Streptavidin
General Introduction of Recombinant Streptavidin

Streptavidin, renowned for its exceptional stability, maintaining its biological activity even under extreme conditions including high temperatures, varying pH levels, and denaturing environments. This tetrameric protein has biotin-binding sites on each monomer, enabling the capture of biotinylated molecules in solution. Widely used in biotechnology, streptavidin serves as an effective immobilization agent for applications such as magnetic beads, microporous plates, and membranes. It also facilitates protein conjugation through robust streptavidin-biotin interactions. Common applications include immunoluminescence, enzyme-linked immunoadsorption, and other advanced biotechnological methodologies.


Synbio Technologies produces recombinant streptavidin using E. coli expression. It is a non-glycosylated protein with a high affinity for biotin. It is ideal for use in solid phase technology and universal detection systems for immunology and molecular diagnostics.
Highlights
  • High Purity
  • High Affinity
  • High Stability
Product Properties
Product Name Recombinant Streptavidin
Amino Acid Sequence MNHKVHHHHHHDPSKDSKAQVSAAEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNA ESRYVLTGRYDSAPATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWL LTSGTTEANAWKSTLVGHDTFTKVKPSAASIDAAKKAGVNNGNPLDAVQQ
Molecular Weight 64kDa
Expression System Escherichia coli
Tag N-Terminus His
Purity SDS-PAGE ≥95%
Activity 15.0 units/mg
Usage Concentration 1 mg/ml, 5 mg/ml, 10 mg/ml (Optional)
Storage Buffer 1×PBS pH 7.4
Storage Condition -20°C, -80°C
Specification 1mg, 10mg, 100mg (Optional)
Transportation Blue ice

* Short-term storage can be stored in -20°C , long-term storage can be divided and stored in -80°C, to avoid repeated freeze-thaw; shelf life of one year.


FAQs
Get in Touch with Us
Related Services
  • Address:
    9 Deer Park Dr., Suite J-25
    Monmouth Junction, NJ 08852

This website stores cookies on your computer. These cookies are used to collect information about how you interact with our website and allow us to remember you.
To find out more about the cookies we use, see our Privacy Policy.

Accept